LL-37 is a synthetic cationic 37-amino acid peptide corresponding to the mature sequence of human cathelicidin ([LL-37, 37 aa]). It is supplied in lyophilized powder form with >99% purity for laboratory research applications.
Disclaimer: For research purposes only. Not intended for human or animal consumption, medical diagnosis, treatment, or any therapeutic application. All sales are subject to federal regulations; buyer must ensure proper handling and legal compliance.
Reviews
There are no reviews yet.